Protein Info for GFF4209 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Serine protease precursor MucD/AlgY associated with sigma factor RpoE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00089: Trypsin" amino acids 52 to 225 (174 residues), 33.5 bits, see alignment E=3.9e-12 PF13365: Trypsin_2" amino acids 55 to 219 (165 residues), 89 bits, see alignment E=5.5e-29

Best Hits

KEGG orthology group: K01362, [EC: 3.4.21.-] (inferred from 62% identity to adn:Alide_0772)

Predicted SEED Role

"Serine protease precursor MucD/AlgY associated with sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>GFF4209 Serine protease precursor MucD/AlgY associated with sigma factor RpoE (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKRRLFHVASLGAIGLLWAASTWAGLADTVLRVKPSVVLVGTFKTTDNPRFQLRGAGFLV
ARGDLVVTSAHVLPSDAGSADEASLVVQVRVGQGDWQMRTATVLETDAARDLTLLRVAGA
PGPALKIGDSRRVREGDDLAFMGFPIGGSLGFSHVTHRATVSTITSAALPSPSAERLREQ
AIRSLRNGTYDIFQLDATAYPGNSGGPLFDPETGEVMGVMNMVLIKNTRESALSQPSGIS
YAIPSRYVQELVDRHR