Protein Info for GFF4207 in Sphingobium sp. HT1-2

Annotation: Hypothetical Nudix-like regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF00293: NUDIX" amino acids 3 to 103 (101 residues), 26.5 bits, see alignment E=8.4e-10 PF19368: AraR_C" amino acids 130 to 194 (65 residues), 31.1 bits, see alignment E=3.5e-11 PF21906: NrtR_WHD" amino acids 135 to 193 (59 residues), 63.5 bits, see alignment E=2.5e-21

Best Hits

KEGG orthology group: K03574, 7,8-dihydro-8-oxoguanine triphosphatase [EC: 3.6.1.-] (inferred from 40% identity to hoh:Hoch_6368)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>GFF4207 Hypothetical Nudix-like regulator (Sphingobium sp. HT1-2)
MTVLDGQLGVLRQRRDQEPFAGRLALPGSFVRPDEDLDAATHRVLAQKVGLSGAWLEQLY
SFDDPARDPRMRIVSISHFALLPADRLKAAVKGRNDLRLVPVDVSETTLAFEHDAIIDLA
RTRLQGKLAYTPVALALLPDQFTLRDLQAVHEGILGTRLNKPALRRRMLDSGWIEATGEK
ETAGAFRSAEVFRQTDRHRSQGKAAAPHMRSSDQ