Protein Info for GFF4201 in Xanthobacter sp. DMC5

Annotation: 3-oxoadipate enol-lactonase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02427: 3-oxoadipate enol-lactonase
  • amino acids 12 to 263 (252 residues), 314.9 bits, E=1.9e-98
• PF00561: Abhydrolase_1
  • amino acids 22 to 251 (230 residues), 105.6 bits, E=9e-34
• PF12697: Abhydrolase_6
  • amino acids 27 to 257 (231 residues), 73.5 bits, E=1e-23
• PF03096: Ndr
  • amino acids 39 to 265 (227 residues), 39.4 bits, E=7.8e-14
• PF12146: Hydrolase_4
  • amino acids 42 to 250 (209 residues), 61.7 bits, E=1.7e-20
• PF08386: Abhydrolase_4
  • amino acids 181 to 244 (64 residues), 21.3 bits, E=5.9e-08

Best Hits

Swiss-Prot: 36% identical to ELH1_ACIAD: 3-oxoadipate enol-lactonase 1 (pcaD) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K01055, 3-oxoadipate enol-lactonase [EC: 3.1.1.24] (inferred from 88% identity to azc:AZC_2343)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

• superpathway of salicylate degradation (7/7 steps found)
• catechol degradation III (ortho-cleavage pathway) (6/6 steps found)
• catechol degradation to β-ketoadipate (4/4 steps found)
• aromatic compounds degradation via β-ketoadipate (7/9 steps found)
• protocatechuate degradation II (ortho-cleavage pathway) (2/4 steps found)
• 4-methylcatechol degradation (ortho cleavage) (4/7 steps found)
• toluene degradation III (aerobic) (via p-cresol) (5/11 steps found)
• mandelate degradation to acetyl-CoA (9/18 steps found)
• superpathway of aerobic toluene degradation (9/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (11/35 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.24

Use Curated BLAST to search for 3.1.1.24

Protein Sequence (265 amino acids)

>GFF4201 3-oxoadipate enol-lactonase 2 (Xanthobacter sp. DMC5)
MPFIAVDGRTTHYALEGAEGAPVLLLANSLGTSFLVWDAVMPALTARFRVLRYDMRGHGL
SDAAPLPDENTGYSIAALAGDALGLLDALGIEKAHVCGLSIGGMVAQHLAAHAPGRVDRL
VLCDTAMQIGPASVWNERLAGIRRDGLPAIAPGVMGRWFTDGFRERVPHIVRGYANMVAR
TTLEGYVGCAMAVRDADLTASAGRISAPTLVVVGDKDPATSPASAEAMAAAIPGARLEVI
ADASHIPCVEQPEALARLLIAHLAG