Protein Info for GFF420 in Xanthobacter sp. DMC5

Annotation: Inner membrane metabolite transport protein YhjE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 253 to 275 (23 residues), see Phobius details amino acids 295 to 315 (21 residues), see Phobius details amino acids 326 to 346 (21 residues), see Phobius details amino acids 352 to 375 (24 residues), see Phobius details amino acids 390 to 412 (23 residues), see Phobius details amino acids 418 to 438 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 20 to 443 (424 residues), 103.4 bits, see alignment E=1.5e-33 PF07690: MFS_1" amino acids 27 to 403 (377 residues), 92.7 bits, see alignment E=2.3e-30

Best Hits

Swiss-Prot: 56% identical to YHJE_ECOLI: Inner membrane metabolite transport protein YhjE (yhjE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 83% identity to sno:Snov_1547)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>GFF420 Inner membrane metabolite transport protein YhjE (Xanthobacter sp. DMC5)
MSTTFAADAAPAVNPRSRVILASLIGTTIEFYDFYVYATAAVLVFPHLFFPAGNDTTALL
ASFAIFGAAMVARPLGAIFFGHLGDKKGRKLTLVGALLTMGIATFLIGLLPTFQTAGWFA
PLLLVILRLAQGFALGGEWSGAALVATENAPAGKRAVYGTFPQLGAPIGFIIANGLFLAI
AALMPSSDPSRPSDAFLSWGWRLPFLFSAVMVIVGLWVRISLVESPAFAKALEHGRIQKL
PLAAAFKTHWRELILGTFYMLATYVLFYLMTTFSLSYGRAPTTAAVPGLGYDYRTFVLMM
IGGVVFFGIFTLVSGPWADRWGRRRTLIGITAAIVVFGLLWVPILSAGPVGVMAWLVIGF
TLMGLTFGPMGALLPELFPANVRYTGSGISYNVSSILGAAVAPFIAVALWSYGGGSPFWV
GIYLSVMALLTLIALVLGKETRDVNMDH