Protein Info for PS417_21470 in Pseudomonas simiae WCS417

Annotation: peptidase S49

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 40 to 61 (22 residues), see Phobius details amino acids 143 to 159 (17 residues), see Phobius details amino acids 173 to 187 (15 residues), see Phobius details PF01343: Peptidase_S49" amino acids 141 to 282 (142 residues), 106 bits, see alignment E=9.3e-35

Best Hits

KEGG orthology group: K04773, protease IV [EC: 3.4.21.-] (inferred from 98% identity to pfs:PFLU4711)

Predicted SEED Role

"Periplasmic serine proteases (ClpP class)"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U2T0 at UniProt or InterPro

Protein Sequence (327 amino acids)

>PS417_21470 peptidase S49 (Pseudomonas simiae WCS417)
MSDEWKAPEKAENSDDKSWKLLEKTLLASVQEQRRARRWGIFFKLLTFIWLIAMLALFSP
LMDMEKSATRGANYTALIEVRGVIADKEPASADNIVSSLRAAFEDPKVKGVILRINSPGG
SPVQSGYVYDEIRRLRALHPDIKLYAVISDLGASGAYYIASAADQIYADKASLVGSIGVT
AAGYGFVGTMEKLGVERRTYTSGEHKAFLDPFQPQKADETQFWQGVLDTTHRQFIASVKQ
GRGDRLKDKDHPELFSGLVWSGEQALPLGLIDGLGSASSVARDVIGEKELVDFTVEESPF
DRFSKKLGASVAEKLALYMGFQGPTLR