Protein Info for GFF4191 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF03473: MOSC" amino acids 54 to 173 (120 residues), 127.1 bits, see alignment E=3.8e-41 PF03475: YiiM_3-alpha" amino acids 182 to 224 (43 residues), 27 bits, see alignment 3.3e-10

Best Hits

KEGG orthology group: None (inferred from 72% identity to adn:Alide_0306)

Predicted SEED Role

"Uncharacterized protein conserved in bacteria"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>GFF4191 Uncharacterized protein conserved in bacteria (Hydrogenophaga sp. GW460-11-11-14-LB1)
VSEAPVVIGRLRAVLTGQARPYTRAGSVSAIDKRPRDGAVLAGPTGLDGDEQGDPRVHGG
PDKAVHCYTWAHYGAWRRELPGETAEALLRQPGAFGENLSLEPGLDETNVCIADQWVVGG
ALFEVSQGRQPCWKLNDRFGVPDMARRVQESGRAGWYLRVLRPGLVQAGDAVRLVARPHP
DWALARLLSAIAERDVDPHTLAQILALPLPPSWARLFSRRLETGQIEAWASRLDGAGG