Protein Info for GFF4188 in Variovorax sp. SCN45

Annotation: Signal peptidase I (EC 3.4.21.89)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR02227: signal peptidase I" amino acids 10 to 204 (195 residues), 150.1 bits, see alignment E=2.6e-48 PF10502: Peptidase_S26" amino acids 11 to 198 (188 residues), 140.7 bits, see alignment E=2.4e-45

Best Hits

KEGG orthology group: K03100, signal peptidase I [EC: 3.4.21.89] (inferred from 67% identity to cvi:CV_3687)

Predicted SEED Role

"Signal peptidase I (EC 3.4.21.89)" in subsystem Signal peptidase (EC 3.4.21.89)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.89

Use Curated BLAST to search for 3.4.21.89

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>GFF4188 Signal peptidase I (EC 3.4.21.89) (Variovorax sp. SCN45)
MRRWLGANKGFLVFLLCFGVFRTAVADWNPIPSGSMRPNLLEGDVVFVNRLAYNVKVPLT
DVVLARIGEPRRGDVVTFSSPQDGTRLIKRLVAVPGDRVEMRNEVLFINGEAARYVAPEA
IRETVAPGRTVGATRLTEQVQGNERRVQWLHGIAARSSFAPLVVPEGEYLMLGDNRDDSA
DSRYIGLVPRHLLIGRALRILVSADIKHDWMPRLERFGRKL