Protein Info for PS417_21425 in Pseudomonas simiae WCS417

Annotation: 4-amino-4-deoxychorismate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03461: aminodeoxychorismate lyase
  • amino acids 4 to 263 (260 residues), 295.2 bits, E=1.8e-92
• PF01063: Aminotran_4
  • amino acids 25 to 245 (221 residues), 166.5 bits, E=4.4e-53

Best Hits

KEGG orthology group: K02619, 4-amino-4-deoxychorismate lyase [EC: 4.1.3.38] (inferred from 92% identity to pfs:PFLU4702)

Predicted SEED Role

"Aminodeoxychorismate lyase (EC 4.1.3.38)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis (EC 4.1.3.38)

MetaCyc Pathways

• superpathway of chorismate metabolism (44/59 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• 4-aminobenzoate biosynthesis I (2/2 steps found)
• 4-aminobenzoate biosynthesis II (1/2 steps found)
• superpathway of candicidin biosynthesis (3/11 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.38

Sequence Analysis Tools

See A0A1N7UAS3 at UniProt or InterPro

Protein Sequence (271 amino acids)

>PS417_21425 4-amino-4-deoxychorismate lyase (Pseudomonas simiae WCS417)
MHSWVDGQPADSVPLKDRGLAYGDGLFETIAVRAGQPVLLDRHLQRLDEGCRRLALVADR
ELIRSEVLAYAAALGDGVLKLILTRGDSLRGYGINLGAPVRRILQGSPPATYPHAHAADG
IRLFACATRLAEQPLLAGLKHLNRLEQVIARAEWQDTEHAEGLMLDVSGRVIEGVFSNLF
LVRNGLLLTADLTRCGVAGVMRAEILAQAQSLGIPVAVADIDLEQVQQADEVFVCNSVYG
IWPVRGYAAMSWPVGPLTRKLQAIVRALLEI