Protein Info for GFF4183 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 218 to 241 (24 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 273 to 290 (18 residues), see Phobius details PF00892: EamA" amino acids 18 to 146 (129 residues), 43.6 bits, see alignment E=1.9e-15 amino acids 160 to 289 (130 residues), 42.9 bits, see alignment E=3.1e-15

Best Hits

KEGG orthology group: None (inferred from 77% identity to sjp:SJA_C1-35210)

Predicted SEED Role

"protein of unknown function DUF6, transmembrane"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>GFF4183 hypothetical protein (Sphingobium sp. HT1-2)
MDRPLSSPRSPSVLLPFLICCLGVALFSVMDAAMKGLSLSIGLYNALLWRAITGSLLGLA
LMLATRQRWPNRSVLRLHLLRGVVVALMASFFFWAIMRLPLAEAIALSFIAPLIALYLAA
LLLKERIGRQAIGASLLGLVGVGVILSGRMRGDYDGDALMGAGAVLLSAMLFAWNLILQR
QQAQLASPIEVAFFQHLVMLGVFAIGAPAWAIVPTGSAVPLVLLAAILAFTSLAALAWAY
ARAEAQRLIPVEYTAFVWAAIFGWLAFGEQLTLTTLAGALLIVAGCLIAARTKRADIAHV
EAGAA