Protein Info for GFF4180 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 779 transmembrane" amino acids 51 to 70 (20 residues), see Phobius details PF02368: Big_2" amino acids 84 to 164 (81 residues), 32.5 bits, see alignment E=3.4e-12 amino acids 169 to 239 (71 residues), 36 bits, see alignment E=2.7e-13 amino acids 261 to 332 (72 residues), 31.1 bits, see alignment E=9.3e-12 amino acids 352 to 426 (75 residues), 29.7 bits, see alignment E=2.5e-11 amino acids 444 to 527 (84 residues), 32 bits, see alignment E=4.7e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (779 amino acids)

>GFF4180 hypothetical protein (Variovorax sp. SCN45)
MAHRIARLSGDVAHGDHRTPLRLARGRWRHLPSWKGLFIRSSIRLDWLGRLQLLVLLGFA
ALAGCSGGGGGGGGAELAIPLLRSVEVSPANPFVAAGTSAQLKATAIYTDNSNRDVTAEA
AWTSGSPAVATVGARNGKAVGVAPGTSAMTATFGGQAGHATLTVTSATVARLEVTPATAS
VATGTQVQFAATGVFTDNSTQDLTADVDWTTSASSIATIGAAGRASGLAQGETTITATCR
ASTCGAASGSAILSVTAAALQSIAVTPSAPSLALGTSTTLVATGTYSDNSVHDLSDQVTW
QSGTASVATVSNAAGTHGAVQTLAVGSTAITASLRGVMSPSINLTVTPATLASITVTPVN
PSVAAGLTQGFAAVGTFTDQSTQDLTDQVTWASGNTAVATISNAGGSHGQASATAIGTSS
ITAAMGLVTSLPATLTVTPATLVSMTVTPSTASVASGATQSFTASGIYTDGSIQDLTATA
TWASSVTTIATVSNAAGSKGLATGGMGGSATITAQVGSVSASGTLTVQPTTFSTVGAYTW
TVLAGVTAVQIVATGGGGGGGVAGNLSSGGNGGRVTATLTVTPGDVLDLFVGGGGGQNLA
GGGGGATTVNAGASNQIIAGGGGGAGFSIDAVANGGDGGGNGTDAGAGGTTATGGRGGSG
GVGGAGGPPSPNPGMAGGSGNGGIGGVSGLGAAGGLSVLGAGIGGSVPGGASGGGGGGGG
SGGGGYGGGGSGTWGGINDGGGGGGGSTGPAGAVFTVGANGGVSRSNGGDGSISISIAP