Protein Info for GFF4176 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 PF13646: HEAT_2" amino acids 12 to 74 (63 residues), 35.5 bits, see alignment E=3.1e-12 amino acids 122 to 192 (71 residues), 38.8 bits, see alignment E=2.8e-13 amino acids 140 to 224 (85 residues), 50.1 bits, see alignment E=8.4e-17 amino acids 171 to 247 (77 residues), 35.5 bits, see alignment E=3e-12 amino acids 202 to 273 (72 residues), 44.2 bits, see alignment E=6e-15 amino acids 233 to 317 (85 residues), 64.1 bits, see alignment E=3.5e-21 PF02985: HEAT" amino acids 202 to 225 (24 residues), 17.9 bits, see alignment (E = 8.6e-07) PF03130: HEAT_PBS" amino acids 247 to 273 (27 residues), 13.6 bits, see alignment (E = 2.6e-05) amino acids 278 to 304 (27 residues), 24.5 bits, see alignment (E = 7.5e-09)

Best Hits

KEGG orthology group: None (inferred from 86% identity to xau:Xaut_2803)

Predicted SEED Role

"FOG: HEAT repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>GFF4176 hypothetical protein (Xanthobacter sp. DMC5)
MAIFDDFDDDLDAVAERARDADPGIRRVAMLGLAESVDPGAVDLLLAGLKDEDAGVREAA
AKSLDEHSGLPAALGLAEALDDAVEAVRLAAAESLADKKEPASAPRLIERAQETGGPLSA
FVRTSALRALRDMQDASAMPVALAALTDPDMAVRREALGVLGYLKADAALPALLLAATDP
EPAVRRAVMAALVFVRSGTAGVPALIAGLSDGHWQVREEAAYSIGKAKILEAVDPLIVAA
NDDAWQVKAKAVNALGKLKARAAVPVVSEALGDQLSNVRKEAAAALGEIADPAAVPALEA
VYDDPDPDVRKLVRWAIDRCRAA