Protein Info for GFF4173 in Sphingobium sp. HT1-2

Annotation: Protoporphyrinogen IX oxidase, novel form, HemJ (EC 1.3.-.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details PF03653: UPF0093" amino acids 6 to 146 (141 residues), 168 bits, see alignment E=8.3e-54

Best Hits

Swiss-Prot: 41% identical to Y2845_RHOS4: UPF0093 membrane protein RHOS4_28450 (RHOS4_28450) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K08973, putative membrane protein (inferred from 85% identity to sjp:SJA_C1-35280)

Predicted SEED Role

"Protoporphyrinogen IX oxidase, novel form, HemJ (EC 1.3.-.-)" (EC 1.3.-.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (146 amino acids)

>GFF4173 Protoporphyrinogen IX oxidase, novel form, HemJ (EC 1.3.-.-) (Sphingobium sp. HT1-2)
MPYLGAAYLWVKAAHVIFVIFLMAGLFMMPRFFVYHQETVPGSAEDQRWIERETRLLKII
LNPSLILTWVFGLMLMVEIGAWHFGWFHLKLLFVLALSGYHGWIASYAKKLARGQRSLAD
KQLRMLNEVPGIAAAVIVIMVIVRPF