Protein Info for GFF4169 in Sphingobium sp. HT1-2

Annotation: Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 125 to 146 (22 residues), see Phobius details TIGR00507: shikimate dehydrogenase" amino acids 9 to 258 (250 residues), 208.9 bits, see alignment E=4e-66 PF08501: Shikimate_dh_N" amino acids 10 to 93 (84 residues), 78.5 bits, see alignment E=5.7e-26 PF01488: Shikimate_DH" amino acids 119 to 190 (72 residues), 29 bits, see alignment E=1.6e-10 PF18317: SDH_C" amino acids 238 to 261 (24 residues), 30.6 bits, see alignment (E = 3.4e-11)

Best Hits

Swiss-Prot: 61% identical to AROE_SPHAL: Shikimate dehydrogenase (NADP(+)) (aroE) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 88% identity to sjp:SJA_C1-00030)

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.25

Use Curated BLAST to search for 1.1.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>GFF4169 Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25) (Sphingobium sp. HT1-2)
MTDKLPYAEVIGDPIDHSKSPLIHNFWLQALDIEAEYKKTHVTPEGLSAYFLQRRADPDW
LGCNVTIPHKIAVMDYTDDPGGVRDRIGAMNTIASETAGPLIGTNTDAGGFLQPLLRDKW
KGRHAVLIGAGGAARAILFALTSLGVPEITIMARDPAKGQALLDRAGVKGKVIGMTDALP
AADLLVNSTSLGMVGQPALDLDLSPLPASATVYDIVYAPLETGLLKAARDRGLKTLDGLE
MLIGQAALAFDIFFDAEAPRELDAELRALLTAAD