Protein Info for GFF4168 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 2 (cluster 5, nickel/peptides/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 signal peptide" amino acids 7 to 7 (1 residues), see Phobius details transmembrane" amino acids 8 to 28 (21 residues), see Phobius details amino acids 73 to 96 (24 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 185 to 210 (26 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 86 to 269 (184 residues), 99.2 bits, see alignment E=1.3e-32

Best Hits

Swiss-Prot: 42% identical to Y1093_BRUSU: Putative peptide transport system permease protein BRA1093/BS1330_II1085 (BRA1093) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 72% identity to axy:AXYL_03699)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>GFF4168 ABC transporter, permease protein 2 (cluster 5, nickel/peptides/opines) (Variovorax sp. SCN45)
MKLRKMNAAIGGTILGAIALAAGIGLFWTPFDPVTLGYAKRLAAPDAVHWLGTDEFGRDV
LSRLMTAAATSARISVLTVATAVLLGTLVGVLSGYLRGWTDRVLMAFNDALLAFPGILLA
LGFLAVAGANEYGIVVALGIAYAPSVARIVRGTVMSLREMDYIAASRLMGNSEFFIVWRH
VLPNCVAPLVVLATSMFGWALLAESALSFLGLGVPPPAPTWGNMLAGSRPFIAKAVWLAI
FPGACISLTLLGINLLGDALRDRLDPRMRNT