Protein Info for GFF4163 in Xanthobacter sp. DMC5

Annotation: Ferrochelatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 TIGR00109: ferrochelatase" amino acids 24 to 347 (324 residues), 267.5 bits, see alignment E=9.4e-84 PF00762: Ferrochelatase" amino acids 26 to 346 (321 residues), 345.6 bits, see alignment E=1.2e-107

Best Hits

Swiss-Prot: 64% identical to HEMH_AGRVS: Ferrochelatase (hemH) from Agrobacterium vitis (strain S4 / ATCC BAA-846)

KEGG orthology group: K01772, ferrochelatase [EC: 4.99.1.1] (inferred from 90% identity to xau:Xaut_2814)

Predicted SEED Role

"Ferrochelatase, protoheme ferro-lyase (EC 4.99.1.1)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.99.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.99.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>GFF4163 Ferrochelatase (Xanthobacter sp. DMC5)
MIDAPAFSADSTHLPKDHPKVAFGRVGVLIVNLGTPEATDYWSMRAYLKEFLWDRRVIEV
NRALWWFVLNAIILTKRPGPKGRDYASIWNNERNEGPLKTITRDQAEKLAAHFAGIDERI
VVDFAMRYGKPPIAERLAALQAQGCERILLVPLYPQYAAATSATVCDKAFDALKEMRWQP
TLRVAPPWHDDPVYIDAVARDLERNLAALDFEPEVILASFHGVPKSYLLKGDPYHCQCAK
TARLLRARLGMDEKRFRLTFQSRFGREEWLKPYTDETVKALATSGVKRLAVFNPGFVADC
LETLEEIGVENREIFEHAGGEKFAAIPCLNAGDEGMRVLGTVVERELKGWVG