Protein Info for GFF4154 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 51 (20 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 208 to 237 (30 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 7 to 260 (254 residues), 155.1 bits, see alignment E=1e-49

Best Hits

KEGG orthology group: None (inferred from 54% identity to ddf:DEFDS_0930)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>GFF4154 ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate) (Variovorax sp. SCN45)
MGAYETSILTLVAINVILALSLNLISGLCGQVSLGHAAFFGVGAYATALLAKAGANLWLT
LPAALLLAGVCGLVVGFCSLRVRDDFLAIATMAAGFLFLGVVRTSDALGGELGISQIPES
GLEGFYPYFVVLCAVAAGVFCTWVKKSWLGYAFEAVSADETAARSLGIDTPRFKLAAFAL
GTGLAGVAGCLYAYYLGTVGVEAFGFPVSVMILAMVVIGGMGSIWGSVLAAALLTLAPEW
FRFINDYKLLVFGLLLFVMMRFVPGGLFPLVLRQARRLRGEAAR