Protein Info for GFF4145 in Xanthobacter sp. DMC5

Annotation: Ribosomal RNA small subunit methyltransferase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 TIGR00755: ribosomal RNA small subunit methyltransferase A" amino acids 20 to 276 (257 residues), 231 bits, see alignment E=7.2e-73 PF00398: RrnaAD" amino acids 20 to 277 (258 residues), 163.2 bits, see alignment E=3.3e-52

Best Hits

Swiss-Prot: 90% identical to RSMA_XANP2: Ribosomal RNA small subunit methyltransferase A (rsmA) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K02528, 16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC: 2.1.1.182] (inferred from 90% identity to xau:Xaut_2833)

Predicted SEED Role

"SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase (EC 2.1.1.182)" (EC 2.1.1.182)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.182

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>GFF4145 Ribosomal RNA small subunit methyltransferase A (Xanthobacter sp. DMC5)
MSALDDLPPLRDVIRRHGLSAQKSLGQNFLLDLNLTGRIARASGPLEDVTVVEVGPGPGG
LTRALLALGAKRVIAIERDRRCMDALAEVAAHYPGRLEVIEGDALKVDVRPLIGEGEARV
VANLPYNIATVLLVGWLSTDPWPPWFSSLTLMFQKEVAERIVAEPGSKAYGRLAVLAGWR
TKGRIAFDVAPSAFVPPPKVTSSVIHLVPRAEPLPCALSALEKVTESAFGQRRKMLRQSL
KTLGVDAQALLAAAGVEETARAEEIDVAGFVRLANAFSEGVGRQFGALSALK