Protein Info for GFF4140 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 46 to 78 (33 residues), see Phobius details amino acids 99 to 123 (25 residues), see Phobius details amino acids 337 to 355 (19 residues), see Phobius details amino acids 366 to 387 (22 residues), see Phobius details amino acids 395 to 418 (24 residues), see Phobius details PF03739: LptF_LptG" amino acids 6 to 219 (214 residues), 184.8 bits, see alignment E=1.2e-58 amino acids 274 to 413 (140 residues), 47.1 bits, see alignment E=8.9e-17

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>GFF4140 hypothetical protein (Xanthobacter sp. DMC5)
MGRLDRYIFSTAAVAFLGVVVVLAGMIWATQALRQLDLVTSQGQTILAFIAITSLTMPTL
VLVIAPAALFIATAYTLLKLNGDSEIVVMAAAGMGPWRLLRPLILLAILVSLFCSSLAVH
VVPASLTSFREQVTKVRADVVSFVAQPGRFVNLTQGLVFHVRERSANGVMRGIFINDARE
KEVSTYLADRGQIVESKAGIFLVLENGSIHRRGGDLWKTEATPQPTPEEARAAARAKLAA
QNAGGQVARASEPAAPAAAAPAAGDQKQGRSDSKAANSSVVEFQRYAFDLSSLAPDNKGV
DIKPMERPLTYVMNPPPEDMYVRFFPGRYREELHKRLSAGLYPMAFFAIAAAALAQPRTT
RQSRGAALTAIIPAMGLVQIGNFAIAGQLKANAAAVPLIYALPIVTVIICAMVLQGWIRL
APPAALTAFIDSIRARFSRRAAA