Protein Info for GFF4138 in Xanthobacter sp. DMC5

Annotation: Peptide methionine sulfoxide reductase MsrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 TIGR00357: methionine-R-sulfoxide reductase" amino acids 16 to 137 (122 residues), 182.5 bits, see alignment E=1.8e-58 PF01641: SelR" amino acids 25 to 138 (114 residues), 174.2 bits, see alignment E=4.2e-56

Best Hits

Swiss-Prot: 63% identical to MSRB_THEEB: Peptide methionine sulfoxide reductase MsrB (msrB) from Thermosynechococcus elongatus (strain BP-1)

KEGG orthology group: K07305, peptide-methionine (R)-S-oxide reductase [EC: 1.8.4.12] (inferred from 81% identity to xau:Xaut_2840)

MetaCyc: 56% identical to methionine sulfoxide reductase B (Escherichia coli K-12 substr. MG1655)
L-methionine (R)-S-oxide reductase. [EC: 1.8.4.14]; Peptide-methionine (R)-S-oxide reductase. [EC: 1.8.4.14, 1.8.4.12]

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)" (EC 1.8.4.12)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.12 or 1.8.4.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (147 amino acids)

>GFF4138 Peptide methionine sulfoxide reductase MsrB (Xanthobacter sp. DMC5)
MSTSAPSDADHTKVVKSESEWRSCLTPEQFRITRQAGTERAFTGPYWDEKRAGLYECVAC
GAPLFRSETKYNSGTGWPSFFQPVSPEAVVTHEDVSHGMRRIEVRCASCDSHLGHVFPDG
PAPTGLRFCMNGTALSLKTDDGADRGV