Protein Info for GFF4133 in Xanthobacter sp. DMC5

Annotation: Adaptive-response sensory-kinase SasA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 586 transmembrane" amino acids 42 to 61 (20 residues), see Phobius details amino acids 274 to 297 (24 residues), see Phobius details PF13755: Sensor_TM1" amino acids 27 to 90 (64 residues), 88.7 bits, see alignment E=4.2e-29 PF13756: Stimulus_sens_1" amino acids 126 to 235 (110 residues), 131.8 bits, see alignment E=3.8e-42 PF00672: HAMP" amino acids 292 to 345 (54 residues), 28.8 bits, see alignment 3.1e-10 PF00512: HisKA" amino acids 353 to 416 (64 residues), 58.5 bits, see alignment E=1.4e-19 PF02518: HATPase_c" amino acids 468 to 585 (118 residues), 92.6 bits, see alignment E=5.7e-30

Best Hits

KEGG orthology group: K14980, two-component system, OmpR family, sensor histidine kinase ChvG [EC: 2.7.13.3] (inferred from 92% identity to xau:Xaut_2846)

Predicted SEED Role

"Sensor histidine kinase ChvG (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (586 amino acids)

>GFF4133 Adaptive-response sensory-kinase SasA (Xanthobacter sp. DMC5)
MTVETNEAPLERPSEPAGILATVRRVRRFVAFKGFSSLTRRIVLLNLAGLCALVSGILYL
SEFRSGLIDARIQSLLVQGEIIAAAIASSAQVETNAITLDPDRLLELQAGESYGPEDGFA
PLEFPINPERVAPVLRRLVGPTRTRARIYDREGQLLLDSRSLYSRGEILRFDLPSPNEPK
PSFLERAWLGVQLWLGRGDLPLYREMGPQSGKNYPEVASAALGTKASEVRVDERGQVVVS
VAVPIQRFRAILGVLLLSTQSGEIDAAVKAERFVIVRVFLVAAAVMVLLSVLLAGTIADP
VRKLAAAAERVRRRIKTRVEIPDFTARADEIGHLSGALRDMTSALYNRIEAIESFAADVA
HELKNPLTSLRSAVETLPLAKTDSSRSRLLEVIQHDVKRLDRLISDISDASRLDAELQRQ
EAVTVDLKQLLEMVVGLAQDVRKDDGVSVSLSFDRAAGAPQDYNIAGHSSRLGQVVDNLV
SNARSFSPQGGSVRVTCRRLKDGAEIMVDDDGPGIRPDALSRIFERFYTDRPHQGFGQNS
GLGLSISRQIVEAHGGRIWAENRTATDPDGTPHVTGARFVVRLPTG