Protein Info for GFF4133 in Sphingobium sp. HT1-2

Annotation: tRNA-5-carboxymethylaminomethyl-2- thiouridine(34) synthesis protein MnmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 PF10396: TrmE_N" amino acids 4 to 119 (116 residues), 107.2 bits, see alignment E=9.1e-35 PF12631: MnmE_helical" amino acids 122 to 425 (304 residues), 123.6 bits, see alignment E=1.9e-39 TIGR00231: small GTP-binding protein domain" amino acids 217 to 313 (97 residues), 55 bits, see alignment E=4.2e-19 PF01926: MMR_HSR1" amino acids 218 to 308 (91 residues), 75.3 bits, see alignment E=6.6e-25

Best Hits

Swiss-Prot: 50% identical to MNME_ZYMMO: tRNA modification GTPase MnmE (mnmE) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K03650, tRNA modification GTPase (inferred from 76% identity to sch:Sphch_2254)

Predicted SEED Role

"GTPase and tRNA-U34 5-formylation enzyme TrmE" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>GFF4133 tRNA-5-carboxymethylaminomethyl-2- thiouridine(34) synthesis protein MnmE (Sphingobium sp. HT1-2)
VSETIFALSSGAPPAGIGVVRVSGPMAGAALQALAGRLPTPRMASLALLSDPRDGTPLDR
ALLLWLPGPRTVTGEDMAELHCHGGRAVIAAVEAALGAMPELRRATAGEFTRRAFAHGRM
DLNEVEGLADLLAAETQQQRRAALAMMEGHFSQRIDGWRMRLLDLSAMAEAALDFSDEDD
VPDADIEARIGQGVMALADDVGALLSAPSAERLRDGIRVVLAGPPNAGKSTLLNRLVGRE
AAIVSDIAGTTRDRIEVPAAIGGTAFLFTDTAGLREETGDAIEAIGIDRARAALEAADII
LWLGEPDEAPREDALLIAAQSDVALFGPERLGLRLSARTGEGMDALVAMLLDRAATLLPG
EGDYALHARQRDGVRALHDHLLAAGAARDLLVLAEELRLGRRMIDALTGQAGTEDMLDRL
FSGFCIGK