Protein Info for GFF4130 in Sphingobium sp. HT1-2

Annotation: Chromosome (plasmid) partitioning protein ParA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF06564: CBP_BcsQ" amino acids 1 to 143 (143 residues), 33.8 bits, see alignment E=8.9e-12 PF13614: AAA_31" amino acids 3 to 178 (176 residues), 207.1 bits, see alignment E=7.2e-65 PF01656: CbiA" amino acids 4 to 228 (225 residues), 103.6 bits, see alignment E=2.6e-33 PF09140: MipZ" amino acids 4 to 161 (158 residues), 43.3 bits, see alignment E=1e-14 PF10609: ParA" amino acids 4 to 45 (42 residues), 35.1 bits, see alignment 3.5e-12 PF02374: ArsA_ATPase" amino acids 10 to 50 (41 residues), 27 bits, see alignment 9.3e-10

Best Hits

Swiss-Prot: 61% identical to PARA_CAUVC: Chromosome partitioning protein ParA (parA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03496, chromosome partitioning protein (inferred from 91% identity to sch:Sphch_2257)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParA" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>GFF4130 Chromosome (plasmid) partitioning protein ParA (Sphingobium sp. HT1-2)
MICIAIANQKGGVGKTTTAINLATGLAATGLRVLLVDLDPQGNASTGLGVNHADRERSSY
DLLVGNCELDEAVVTTRVPKLDLIPATQDLSGAEIELIDYEQRTHRLERVLSEAPAGRWD
ICLIDCPPSLGLLTVNAMVAAQSLLVPLQCEFFALEGLSQLLQTVERIRSRFNTGLSILG
VALTMYDRRNRLTDQVADDVRAVLGDLVFTTVIPRNVRLSEAPSHGVPALIYDFRCSGSE
AYMRLARELIARLPRQEVAA