Protein Info for PS417_21130 in Pseudomonas simiae WCS417

Annotation: nitrate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 transmembrane" amino acids 72 to 99 (28 residues), see Phobius details amino acids 130 to 156 (27 residues), see Phobius details amino acids 172 to 195 (24 residues), see Phobius details amino acids 206 to 224 (19 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 284 to 306 (23 residues), see Phobius details amino acids 325 to 354 (30 residues), see Phobius details amino acids 367 to 385 (19 residues), see Phobius details amino acids 391 to 415 (25 residues), see Phobius details amino acids 445 to 465 (21 residues), see Phobius details amino acids 471 to 488 (18 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 44 to 465 (422 residues), 264.3 bits, see alignment E=1e-82

Best Hits

KEGG orthology group: K03457, nucleobase:cation symporter-1, NCS1 family (inferred from 96% identity to pfs:PFLU4643)

Predicted SEED Role

"Hydantoin permease" in subsystem Hydantoin metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UQ85 at UniProt or InterPro

Protein Sequence (509 amino acids)

>PS417_21130 nitrate reductase (Pseudomonas simiae WCS417)
MRPSLSNNIALDLPSSPLNPEATSPGPLVLSPRLHNKDLAPTKVEGRRWGRYSIFALWTN
DVHNIANYSFAIGLYALGLGGWQILLSLGIGAALVYFFMNLSGYMGQKTGVPFPVMSRIS
FGIHGAQIPALIRAVIAIAWFGIQTYLASVVFRVLLTAIHPGFADYDHNSILGLSSLGWA
CFVAIWLVQLVILAYGMEMVRRYEGFAGPVILLTVASLAGWMYFQTGGNIAWSIRDPLSG
GEMWRNIFAGGALWLAIYGTLILNFCDFARSSPCRKTIQVGNFWGLPVNILVFAAITVLL
CGGQFQLNGRVIESPTEIIAAIPSTFFLVLGCLAFLIVTVAVNIMANFVAPAFVLSNLAP
KYLNFRRAGLISATVAVLILPWNLYNSPLVIVYFLSGLGALLGPLYGVIMVDYWLIRKSR
VDVLQLYSEDPNGVYYYSRGVNLRAVAAFIPAAVIAILLALLPGFASVSPFSWMFGAGIA
GLLYLLIAKRQPFYADVSGESIAVDNVSH