Protein Info for GFF4124 in Sphingobium sp. HT1-2

Annotation: ABC transporter, permease protein (cluster 9, phospholipid)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 transmembrane" amino acids 120 to 141 (22 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details amino acids 257 to 286 (30 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 345 to 368 (24 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 143 to 364 (222 residues), 217.5 bits, see alignment E=1.2e-68 PF02405: MlaE" amino acids 153 to 362 (210 residues), 248 bits, see alignment E=3.9e-78

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 84% identity to sch:Sphch_2263)

Predicted SEED Role

"ABC-type transport system permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>GFF4124 ABC transporter, permease protein (cluster 9, phospholipid) (Sphingobium sp. HT1-2)
MNKAADLVEESRDDGGKVIRLSGTWSIACLHDMPNRLDAISGPIACIDVADIDHMDTIGA
WTIHRTAKRLETEVSGGSTDCKRLIGAVGKIDEPVDIRPTYVSPFNRVLGQIGEAVINSV
NTLVGLLGFFGGVLVTVWGLIRHPSRFRINAVVQRFEVVGVSALGIIGLMSFLIGIVIAQ
QGAVQLRQFGMEMLTINLVGRLTFRELGVLMTAIMVAGRSGSAFAAQLGTMKLTEEVDAM
RTIGVSPMEALVLPRTLAVVVMMPLLGFYSSIIAIIGGGFLCAVSLDIPPITFVQRLREV
VPIHDLWVGLIKAPVFGLIIGISGCFQGMQVKANAEEVGLRTTAAVVQAIFLVIVLDAFF
AVFFTWVGWN