Protein Info for GFF4120 in Sphingobium sp. HT1-2

Annotation: Methionine gamma-lyase (EC 4.4.1.11)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01053: Cys_Met_Meta_PP
  • amino acids 42 to 443 (402 residues), 340.4 bits, E=1.1e-105
• PF00155: Aminotran_1_2
  • amino acids 115 to 215 (101 residues), 22.6 bits, E=5.8e-09

Best Hits

KEGG orthology group: K01761, methionine-gamma-lyase [EC: 4.4.1.11] (inferred from 93% identity to sjp:SJA_C1-00180)

Predicted SEED Role

"Cystathionine gamma-synthase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48)

MetaCyc Pathways

• aspartate superpathway (25/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (18/18 steps found)
• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (9/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (9/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (8/8 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-methionine biosynthesis I (5/5 steps found)
• L-methionine degradation II (3/3 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-threonine degradation I (5/6 steps found)
• superpathway of L-threonine metabolism (13/18 steps found)
• seleno-amino acid detoxification and volatilization III (2/3 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (4/6 steps found)
• dimethyl sulfide biosynthesis from methionine (1/2 steps found)
• seleno-amino acid detoxification and volatilization I (1/2 steps found)
• homocysteine and cysteine interconversion (2/4 steps found)
• superpathway of seleno-compound metabolism (8/19 steps found)
• hypoglycin biosynthesis (4/14 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Cysteine metabolism
• Methionine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.48

Use Curated BLAST to search for 2.5.1.48 or 4.4.1.11

Protein Sequence (446 amino acids)

>GFF4120 Methionine gamma-lyase (EC 4.4.1.11) (Sphingobium sp. HT1-2)
MTGETPPPVTEADLTGVEPPHNRRRPKAPILEIDGRKLKPATLMMGHGYDPTLSEGSLKP
PIFLTSTFAFESAAAGKRHFEGVTGIRPGGAEGLVYSRFNGPNQEIAEDRLSVWEEAEDA
LLFSSGMSAIATTLLALVQPGDVIVHSAPLYAATESLIGRILGRFGVQWLDFPAGATEAE
IGAVIEKAKGLGRVAMLYLESPANPTNVLVDLEAVVARRDALFAGEDHVPPIAIDNTFLG
PLWHRPINHGADLVIYSLTKYAGGHSDLVAGGVLGSNALINSIRLMRNTIGTILDPHSAW
MLLRSLETLELRMSRAGENAEKVCTWLKDQPQVEKVVYLGFPETERQADIYRRHCTGAGS
TFSLYLKGGEAEAFAFLDALKIAKLAVSLGGTETLASHPAAMTHLSVPAERKKALAIGDN
MVRISIGCEDADDLIADFAQALKAIG