Protein Info for PS417_02095 in Pseudomonas simiae WCS417

Annotation: AMP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 103 to 279 (177 residues), 44.9 bits, E=1.4e-15
• PF22818: ApeI-like
  • amino acids 448 to 539 (92 residues), 65.2 bits, E=1.4e-21
• PF07977: FabA
  • amino acids 454 to 537 (84 residues), 27.4 bits, E=4.6e-10

Best Hits

KEGG orthology group: None (inferred from 94% identity to pfs:PFLU0433)

Predicted SEED Role

"FIGfam138462: Acyl-CoA synthetase, AMP-(fatty) acid ligase / (3R)-hydroxymyristoyl-[ACP] dehydratase (EC 4.2.1.-)" (EC 4.2.1.-)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Nucleotide sugars metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Porphyrin and chlorophyll metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.-

Sequence Analysis Tools

See A0A1N7TVK8 at UniProt or InterPro

Protein Sequence (556 amino acids)

>PS417_02095 AMP-binding protein (Pseudomonas simiae WCS417)
MNGLKLEHLLLEPLEQRPVTTEPAMDHAQLWAQSLSLAAGLQARGIQRLAVYLEDAGLLA
IALLGAWRAGVSVLLPADLQPQTRQRWDAAVDAWLTEAADLDALFQTPLSPAALDLDSCQ
LSLCTSGSSGEPKRINKTLRQLANEVEALETLWGPDLKDACIIGSVATQHIYGLLFRVLW
PLCAGRTFVRKQLAFPEDLQRASREHTHFAWVASPALLKRMGDNLDWPALSQVSRVFSSG
GALPVEAAGSLYDRLQQWPTEILGSSETGGIAWRQGAQPWQPFADVHLSQDADGALRIAS
PYLPEGHIEQTADAARIHADGRFELLGRLDRIVKLEEKRISLPMLEHALMTHPWVAETRL
GVVQENRASLGALVVLSDEGLHALRNQGRRTLTQTLRQHLSQHCEALALPRRWRLLRQLP
LNSQGKLPQAQVEGLLLASRPKAPEVLEQVEANGEWTLQLSVPPDLAYFSGHFPVTPVLP
GVVQVEWAFNLGQQLLDLPATFAGMEVLKFQQLVRPGDAIELHLRFDAQRGKLYFAYRNG
VAACSSGRIVLESVNA