Protein Info for GFF4116 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 PF13188: PAS_8" amino acids 19 to 54 (36 residues), 17.4 bits, see alignment 1.1e-06 amino acids 149 to 197 (49 residues), 23.3 bits, see alignment 1.6e-08 amino acids 274 to 326 (53 residues), 21.7 bits, see alignment 5.2e-08 TIGR00229: PAS domain S-box protein" amino acids 148 to 269 (122 residues), 47.9 bits, see alignment E=7e-17 amino acids 270 to 394 (125 residues), 51 bits, see alignment E=7.5e-18 PF00989: PAS" amino acids 149 to 258 (110 residues), 22.9 bits, see alignment E=2.5e-08 amino acids 290 to 384 (95 residues), 26.1 bits, see alignment E=2.7e-09 PF08448: PAS_4" amino acids 157 to 263 (107 residues), 26.1 bits, see alignment E=3.1e-09 PF13426: PAS_9" amino acids 163 to 259 (97 residues), 29.6 bits, see alignment E=2.5e-10 amino acids 291 to 386 (96 residues), 32 bits, see alignment E=4.3e-11 PF00196: GerE" amino acids 435 to 489 (55 residues), 47.2 bits, see alignment 4.7e-16

Best Hits

KEGG orthology group: None (inferred from 65% identity to mno:Mnod_6717)

Predicted SEED Role

"Sensory box transcriptional regulator, LuxR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (510 amino acids)

>GFF4116 hypothetical protein (Xanthobacter sp. DMC5)
MDTDVPNEAALRQQVDRRQLQQIIAGLAEGIVLIDPVDGIVWANERALALHDVADLAGLG
TTAAGYRKTYLLKYRNNHILTDSQYPIDRLLAGEPFENLVVEITHAESPDDGWRRICRIG
GRSLSNTKGEAESHVLVIEDLTDRFTAEERFERTFNANPAPAIICRLSDLRYVKVNQGFL
EMTGYAREDLIGLSVYELDVLEGAPNKETAVACLREGRTISQTEATIRVAQGGSRFVIVA
GQPIELGDEGCMLFTFMDMAERKMAEDALRQSEERFASAFRMTPLPTALSTRESLRLLDV
NAAFVALLGYSEEEAVGRSGPELPIWTSAVVRRQIERKIAESGSFRSIEVQLRTKAGDIL
DCLISGETVAIHGQDCLLTVIQDITERRRSEVELIAAIEAVMQDTSWFSRTVIEKLAELR
RPRRSDKPRVGLADLTAREQEILGFMCEGLADADIVKKLGLTRNTVRNHIARIYSKADVH
SRTAAVVWARERGFTGTPGKKASAPTRSRR