Protein Info for PS417_21045 in Pseudomonas simiae WCS417
Annotation: cysteine synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 43% identical to CYSK_BACSU: Cysteine synthase (cysK) from Bacillus subtilis (strain 168)
KEGG orthology group: K01738, cysteine synthase A [EC: 2.5.1.47] (inferred from 97% identity to pfs:PFLU4625)MetaCyc: 41% identical to L-cysteine desulfhydrase (Fusobacterium nucleatum)
Cystathionine gamma-lyase. [EC: 4.4.1.1, 4.4.1.28]
Predicted SEED Role
"Cysteine synthase (EC 2.5.1.47)" in subsystem Cysteine Biosynthesis or Methionine Biosynthesis (EC 2.5.1.47)
MetaCyc Pathways
- superpathway of branched chain amino acid biosynthesis (17/17 steps found)
- superpathway of L-isoleucine biosynthesis I (13/13 steps found)
- superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
- L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
- glycine betaine degradation III (7/7 steps found)
- D-serine degradation (3/3 steps found)
- L-methionine degradation II (3/3 steps found)
- L-serine degradation (3/3 steps found)
- L-methionine biosynthesis II (5/6 steps found)
- L-cysteine biosynthesis I (2/2 steps found)
- glycine betaine degradation I (6/8 steps found)
- L-cysteine degradation II (2/3 steps found)
- L-tryptophan degradation II (via pyruvate) (2/3 steps found)
- superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)
- L-threonine degradation I (4/6 steps found)
- seleno-amino acid biosynthesis (plants) (3/5 steps found)
- superpathway of L-threonine metabolism (12/18 steps found)
- purine nucleobases degradation II (anaerobic) (16/24 steps found)
- superpathway of L-cysteine biosynthesis (fungi) (3/6 steps found)
- felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
- superpathway of L-cysteine biosynthesis (mammalian) (2/5 steps found)
- L-mimosine degradation (4/8 steps found)
- homocysteine and cysteine interconversion (1/4 steps found)
- glutathione-mediated detoxification I (3/8 steps found)
- L-cysteine biosynthesis VI (reverse transsulfuration) (2/7 steps found)
- hydrogen sulfide biosynthesis II (mammalian) (1/6 steps found)
- superpathway of L-methionine salvage and degradation (8/16 steps found)
- superpathway of seleno-compound metabolism (8/19 steps found)
- hypoglycin biosynthesis (4/14 steps found)
KEGG Metabolic Maps
- Cysteine metabolism
- Glycine, serine and threonine metabolism
- Methionine metabolism
- Nitrogen metabolism
- Selenoamino acid metabolism
- Sulfur metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.5.1.47
Use Curated BLAST to search for 2.5.1.47 or 4.4.1.1 or 4.4.1.28
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7U7I6 at UniProt or InterPro
Protein Sequence (304 amino acids)
>PS417_21045 cysteine synthase (Pseudomonas simiae WCS417) MLHNSILDVIGQTPIVRLAQFSEDLGIEVYAKLESLNPGGSHKARIALGMILDAERRGVL IRDSGQTIIEPSGGNTGIGLVMAGNVLGYKVVLVIPDNYSPEKQKLLRLYGAKVVLSDSR LGNNSHGEKCMELQLENPSYVMLNQQRNGANPQTHRDTTAPEILRAFGEKRADYFVCGIG TGGHITGIGETLKTAWPELRVMGVEPEECDLLKNQHAPHHIQGLSIGLIPSILNLDVIDG MLKVSRQDCIDMMKRIMRTDAISLGLSSAANMVAIARLAPELPPETVVLTMVYDNADSYL PGFE