Protein Info for GFF4107 in Xanthobacter sp. DMC5

Annotation: Protein-methionine-sulfoxide reductase catalytic subunit MsrP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF00174: Oxidored_molyb" amino acids 92 to 263 (172 residues), 177.7 bits, see alignment E=2.3e-56 PF03404: Mo-co_dimer" amino acids 293 to 397 (105 residues), 39.9 bits, see alignment E=6.3e-14 PF17957: Big_7" amino acids 303 to 371 (69 residues), 25.8 bits, see alignment E=2e-09

Best Hits

KEGG orthology group: None (inferred from 86% identity to xau:Xaut_1455)

MetaCyc: 70% identical to sulfite:cytochrome c oxidoreductase molybdenum subunit (Starkeya novella)
Sulfite dehydrogenase. [EC: 1.8.2.1]

Predicted SEED Role

"Twin-arginine translocation pathway signal"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.2.1

Use Curated BLAST to search for 1.8.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>GFF4107 Protein-methionine-sulfoxide reductase catalytic subunit MsrP (Xanthobacter sp. DMC5)
MITRRQALRSVGGMALGAGAGLMAGSRFAALAADTITLPFGNGERPLVVYPGKRALIGLT
ARPPQLETPFSVFNEGILTPNDAFFVRYHLADIPLDIDPTAFRVEVKGKVATPLSLSLDD
LKTKFDPVEFVAVHQCSGNSRGFLEPRVGGGQAGNGLMGNARWKGVPLKAVLEKAGIASG
AVEVAFSGLDRPAMPQTPGFAKSLKLDHALDGEVVLAYQMNGADLPWLNGFPLRLVVPGY
FGTYWVKHLSQITVLDKPLDNFWMATAYRIPDNECACVPPGTKPEKTVPIGRFVVRSFLT
NVVDGSKVAAGKPLPLRGIAFDGGSGIARVEVSADGGRSFAPATLGEDLGKYSFREWRTS
VTVPAGEHAILVRATNVLGKTQPMEATWNPSGYMRNVVETTRIVAA