Protein Info for GFF4107 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein (cluster 3, basic aa/glutamine/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 22 to 50 (29 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 236 to 254 (19 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 54 to 156 (103 residues), 65.3 bits, see alignment E=2.8e-22 PF00528: BPD_transp_1" amino acids 74 to 263 (190 residues), 58.9 bits, see alignment E=2.9e-20

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 85% identity to vap:Vapar_1887)

Predicted SEED Role

"Glutamate transport membrane-spanning protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>GFF4107 ABC transporter, permease protein (cluster 3, basic aa/glutamine/opines) (Variovorax sp. SCN45)
VSALAVRATTSARRFDPREHPWWTALAAVLLVIGIWVATGTTPVALVFLWQWTPALLWGL
FTNIKISVLAMALGTVAGLVVGALSLSPLRFLRVVTRWYVQFFRNAPVLVLIYFTTYVFP
FELHLVKWTVPFPDWIKVVLGLALPTSAVVAEIFRGAIQSIPSAQWEAAQSLAFRRSEIF
RLIVLPQCLRRMLPPWMNLYASITMSTALASLVGAHDVVDTAQIASNTVARTDFTVLVYF
TLLGVFFAYCYPIARATRALERRHARH