Protein Info for GFF4106 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 transmembrane" amino acids 26 to 45 (20 residues), see Phobius details amino acids 83 to 108 (26 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details PF03350: UPF0114" amino acids 18 to 156 (139 residues), 118.3 bits, see alignment E=1.1e-38 TIGR00645: TIGR00645 family protein" amino acids 75 to 192 (118 residues), 144.6 bits, see alignment E=1.8e-46

Best Hits

KEGG orthology group: None (inferred from 87% identity to vei:Veis_3216)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>GFF4106 putative membrane protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSDPVKAQAPIRALPNLIFASRWLQLPLYIGLIAAQAIYVFHFWVELVHLIEAAFGNDVA
LGKLITSIGYKSDVQLTGLNETIIMLVVLALIDVVMISNLLIMVIVGGYETFVSRMHLEN
HPDQPEWLSHVNASVLKVKLATAIIGISSIHLLKTFINAANYDVKVLMWQTIIHVVFLLS
AMAIAMTDRLMAHPPANDAH