Protein Info for GFF4104 in Sphingobium sp. HT1-2

Annotation: Peptide chain release factor 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR00019: peptide chain release factor 1" amino acids 6 to 359 (354 residues), 496.9 bits, see alignment E=1.5e-153 PF03462: PCRF" amino acids 12 to 206 (195 residues), 224.6 bits, see alignment E=1.1e-70 PF00472: RF-1" amino acids 213 to 323 (111 residues), 151.9 bits, see alignment E=6.8e-49

Best Hits

Swiss-Prot: 76% identical to RF1_SPHWW: Peptide chain release factor 1 (prfA) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K02835, peptide chain release factor 1 (inferred from 94% identity to sch:Sphch_2285)

Predicted SEED Role

"Peptide chain release factor 1" in subsystem LMPTP YwlE cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>GFF4104 Peptide chain release factor 1 (Sphingobium sp. HT1-2)
MHISAERIAQIEARRDEVQASMTRADLAPDAFVKLSKEYAEIEPVARAAHEVRRLRQELR
ALEQMAGGEDSDADPLMREMAQEEMQLLKGQLPDAERALALQLLPKDSADARPAMLEIRA
GTGGDEAALFAGDLFRMYQRYADTQGWKMEMLSANASEQGGFKEVVASINGTGVFAKLKF
ESGVHRVQRVPVTESGGRIHTSAATVAILPEPEEVDVQIADSDLKIDIYRASGAGGQHVN
TTDSAVRITHLPTGIVVTQQDERSQHKNKAKAMQVLRARIYEAERERTQSEQAGARKAMV
GSGDRSERIRTYNFPQGRVTDHRINLTLHRLPEILEGPGLAEVIDALVAEDEAARLAQLD
GVA