Protein Info for GFF4103 in Sphingobium sp. HT1-2

Annotation: Peptide chain release factor N(5)-glutamine methyltransferase (EC 2.1.1.297)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF17827: PrmC_N" amino acids 5 to 71 (67 residues), 48.8 bits, see alignment E=1.8e-16 TIGR00536: methyltransferase, HemK family" amino acids 13 to 268 (256 residues), 177 bits, see alignment E=4.4e-56 TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific" amino acids 24 to 267 (244 residues), 245.7 bits, see alignment E=5.1e-77 PF05175: MTS" amino acids 101 to 189 (89 residues), 40.4 bits, see alignment E=4.7e-14 PF13847: Methyltransf_31" amino acids 109 to 182 (74 residues), 39.8 bits, see alignment E=7.8e-14 PF13649: Methyltransf_25" amino acids 112 to 180 (69 residues), 32.1 bits, see alignment E=3e-11

Best Hits

Swiss-Prot: 42% identical to PRMC_CAUVC: Release factor glutamine methyltransferase (prmC) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 76% identity to sjp:SJA_C1-00640)

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>GFF4103 Peptide chain release factor N(5)-glutamine methyltransferase (EC 2.1.1.297) (Sphingobium sp. HT1-2)
VSVADALRDATVSLAAISDTPRLDAELLMAHALGIGRNDLLLRQRDLSVPVTFAVHLQQR
LSGAPIAHILGSRDFWTISLTVTPDVLIPRPDSETLIEAAVDHFRDRSPTTILDLGTGSG
ALLLAALDQWPDATGLGIDASAAALAVAQGNADRLGMGKRARFQLGDWAAGVTGPFDLLL
INPPYIATDAPLAGDVLHDPASALFAGADGLDDYRRIVPQLPALIAPGGMAAIEIGYDQG
QSVSALLRAQGLGVSLRRDLAGHDRCLVATPGE