Protein Info for GFF410 in Sphingobium sp. HT1-2

Annotation: COG3038: Cytochrome B561

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 signal peptide" amino acids 6 to 11 (6 residues), see Phobius details transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 41 to 63 (23 residues), see Phobius details amino acids 78 to 102 (25 residues), see Phobius details amino acids 138 to 155 (18 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 4 to 172 (169 residues), 86.4 bits, see alignment E=2.1e-28 PF04264: YceI" amino acids 251 to 398 (148 residues), 91.8 bits, see alignment E=5.6e-30

Best Hits

KEGG orthology group: None (inferred from 74% identity to sjp:SJA_C1-08090)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>GFF410 COG3038: Cytochrome B561 (Sphingobium sp. HT1-2)
MPQRYSLAAITLHWAIAALLAFQIAVGWALASLGARGFALFQLHKSIGITVLLLTLLRIG
VRWWKPRPAKLEGGWQGALASGVHVGLYAFMLGAPLTGWALVSTAKVKVPTLFFGVIPLP
HLPLPMASHGLAEGGHSLLAWIGIALVVLHVAGALRHHVLMRDGLIWRMVPGRSIALLIG
LPALILGGFLLGRAILPGAAPEAPAAPATNAVEAEDGPAEDNAVAPAANDTAAVAEEPAG
PPPAWAVQPGGKIGFSVGNSGETISGNFSKWTAKIVMDPDHPESADIKVTIDMASASVGD
AYKDGMLPGDEFFGSAAHPTATFVAKGAEKSGANGYRAHGTLTLKGVAKPQAIRFTLSGS
GTSRKVSGSASVARLPFGVGNGDSSTGLDPKVMVTFSFDAKAQ