Protein Info for PS417_20995 in Pseudomonas simiae WCS417

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 118 to 143 (26 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 14 to 61 (48 residues), 50.4 bits, see alignment 1.7e-17 amino acids 109 to 154 (46 residues), 38.7 bits, see alignment 7.3e-14 PF00924: MS_channel_2nd" amino acids 221 to 271 (51 residues), 26.4 bits, see alignment 6.1e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU4614)

Predicted SEED Role

"CmpX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U7H9 at UniProt or InterPro

Protein Sequence (274 amino acids)

>PS417_20995 transporter (Pseudomonas simiae WCS417)
MELDLWTQSLVTAMTALWTKVANFIPNLFGALVLVLLGFVVAKLLDTLLSKLLAKLGLDR
LMAGTGLTKLLGRAGLQVPISTLIGKIVYWFVLLIFLVSAAQSLGLERVSATLDMLALYL
PKVFGGALVLLVGVLLAQLANGLVRGAAEGVGLDYAAGLGRIAQGLVIIISISVAISQLE
VKTDLLNHVIVIVLITVGLAVALAMGLGSREIAGQILAGIYVRELYQVGQQVRVGEVEGQ
IEEIGTVKTTVLTDDGDLVSLSNRILLEQQVSSR