Protein Info for PS417_20985 in Pseudomonas simiae WCS417

Annotation: porin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF05736: OprF" amino acids 1 to 185 (185 residues), 326.2 bits, see alignment E=8.6e-102 PF13505: OMP_b-brl" amino acids 15 to 182 (168 residues), 36.9 bits, see alignment E=6.6e-13 PF00691: OmpA" amino acids 221 to 315 (95 residues), 88.6 bits, see alignment E=4.4e-29

Best Hits

Swiss-Prot: 94% identical to PORF_PSEFL: Outer membrane porin F (oprF) from Pseudomonas fluorescens

KEGG orthology group: K03286, OmpA-OmpF porin, OOP family (inferred from 100% identity to pfs:PFLU4612)

Predicted SEED Role

"Major porin and structural outer membrane porin OprF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0A5 at UniProt or InterPro

Protein Sequence (326 amino acids)

>PS417_20985 porin (Pseudomonas simiae WCS417)
MKLKNTLGLAIGSLIAATSFGVLAQGQGAVEGELFYKKQYNDSVKHIEDGFNPGARIGYF
LTDDLSLNLSYDKTNHTRSNDGTGNQKIKGDTGSLVAQYHFGQAGVDSLRPYVEGGFGHQ
SRTNVQADGHSGRDQTTFATVGTGVKYYFTNNLYARAGVEADYGLDNGKWDYSALVGLGV
NFGGNAGAVAPAPTPAPAPEPTPEPEAPVAQVVRVELDVKFDFDKSVVKPNSYGDVKNLA
DFMAQYPATNVEVAGHTDSVGPDAYNQKLSQRRADAVKQVLVKDGVAPSRITAVGYGESR
PVADNATEAGRAVNRRVEASVEAQAQ