Protein Info for GFF4090 in Variovorax sp. SCN45

Annotation: Glutamate/aspartate ABC transporter, permease protein GltK (TC 3.A.1.3.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 55 to 78 (24 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 14 to 119 (106 residues), 72.2 bits, see alignment E=2.1e-24 PF00528: BPD_transp_1" amino acids 35 to 224 (190 residues), 75.6 bits, see alignment E=2.2e-25

Best Hits

Swiss-Prot: 33% identical to TCYL_BACSU: L-cystine transport system permease protein TcyL (tcyL) from Bacillus subtilis (strain 168)

KEGG orthology group: K10002, glutamate/aspartate transport system permease protein (inferred from 70% identity to rpf:Rpic12D_5112)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>GFF4090 Glutamate/aspartate ABC transporter, permease protein GltK (TC 3.A.1.3.4) (Variovorax sp. SCN45)
MGYDFDWASLQRAWPYLLQGLQMTAFLVAASMAAGMGLGTLLAITRIFAPRPVAALVAGY
VNLFRSIPLILTILWIYFLMPVVLRSVTGDPNLSVGPIYAALVAFVLAESAYYCEIIRAG
IGSVRAGQMQAAQSLGMSPWQAMRHVILPQAFRNMTPSLINQTIALLKDTSLVYVISLND
FLGAASKVGQRDGRVVEVYILVAVVYLVLCTAGAWWITWLQRRKAAAAI