Protein Info for GFF409 in Variovorax sp. SCN45

Annotation: Osmolarity sensory histidine kinase EnvZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details PF16524: RisS_PPD" amino acids 55 to 161 (107 residues), 130.6 bits, see alignment E=6e-42 PF00672: HAMP" amino acids 186 to 238 (53 residues), 34.9 bits, see alignment 3.2e-12 PF00512: HisKA" amino acids 246 to 302 (57 residues), 38.8 bits, see alignment 1.6e-13 PF02518: HATPase_c" amino acids 341 to 454 (114 residues), 82.7 bits, see alignment E=5.1e-27

Best Hits

KEGG orthology group: K07638, two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC: 2.7.13.3] (inferred from 97% identity to vpe:Varpa_3341)

Predicted SEED Role

"Osmolarity sensory histidine kinase EnvZ"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>GFF409 Osmolarity sensory histidine kinase EnvZ (Variovorax sp. SCN45)
MPSPLEASAQRDRRPGLKLGFSLFWRTFFLLALLLIGCTVAWLQTFRSLEYEPRAIQTAH
QIASLVNLTRAALVYSDAITRVSLIKTLADQEGVRILPREPNDRFEPYTSGALDLRVTEE
LIDQLGEGTTVASRVNDEAGLWIGFTIESDTYWLLLDPTRFSRVGGRTWLVWLSTAMALS
LAGAALITRLINLPLKQLSRATMQVREGEYEAHRLDERARTNEIRAVNIGFNRMADQLAK
IEQDRAIMLAGISHDLRTPLARLRLETEMSVADEDARDHMAADIAQLDAIIDKFLDYARP
DHVDPRPVLLRDVVDACTYAVQDYEEMNITVDVPADLRVLGDEVELTRVISNLVENARRY
GKTPSTGVADVTIQAQANNDAVLIKVRDHGAGVEPALLSQLTKPFFRGDTARTSAAGAGL
GLSIVAKNIERMGGTFALTSTPGRGLAAHIRMPRAMPTSAGKPGESQGGKKPT