Protein Info for GFF4083 in Sphingobium sp. HT1-2

Annotation: FIG01094649: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF04389: Peptidase_M28" amino acids 95 to 212 (118 residues), 25.7 bits, see alignment E=1.3e-09 PF01546: Peptidase_M20" amino acids 108 to 424 (317 residues), 75.7 bits, see alignment E=7.4e-25 PF07687: M20_dimer" amino acids 215 to 329 (115 residues), 54.1 bits, see alignment E=2e-18

Best Hits

KEGG orthology group: None (inferred from 63% identity to swi:Swit_4723)

Predicted SEED Role

"FIG01094649: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>GFF4083 FIG01094649: hypothetical protein (Sphingobium sp. HT1-2)
MRQTIVKAALCGAMLLATTAQAALSPAEQKIGASVDAGHEPAIALLEKIVNQNSGSMNVA
GVKAVADMLRPEFEALGFVVTWKPMDQVKRAGHFIAVHKGKVGTTKMLLIGHLDTVFEPD
SPFQTFKREGDWAAGPGVGDDKGGVVTMLLALKAMQAAGTLKNANIEVVLTGDEEDSGDP
VSISRADLIAAGKRADVALDFEGLSREDGKDMGSIARRSSNSWTLTTSGKSAHSSGIFSA
AAGDGAVYEMARIITAFRKELPEPNLTFNVGLIGGGQSADVDKDGVRIAVTGKTNIIPPI
AVAKGDFRTLSQDQTERVRAKMQAIVDSGHLPGTGASIAFDLGYPSMAPTAGNRALLGKL
NGINKDLGLPEMPELDPLKRGAGDISFVAQDVDGLVGLGLASTGDHSPAEKADLSTMPRQ
AKRAAILMTRLSAEKGRK