Protein Info for GFF4081 in Xanthobacter sp. DMC5

Annotation: Gluconate 5-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF23441: SDR
  • amino acids 10 to 250 (241 residues), 40.2 bits, E=6.6e-14
• PF00106: adh_short
  • amino acids 14 to 203 (190 residues), 158.2 bits, E=4.7e-50
• PF08659: KR
  • amino acids 14 to 188 (175 residues), 39.8 bits, E=1.2e-13
• PF13561: adh_short_C2
  • amino acids 22 to 251 (230 residues), 174.9 bits, E=5.3e-55

Best Hits

Swiss-Prot: 32% identical to TRNHB_ARATH: Tropinone reductase homolog At2g29340 (At2g29340) from Arabidopsis thaliana

KEGG orthology group: K00046, gluconate 5-dehydrogenase [EC: 1.1.1.69] (inferred from 63% identity to vei:Veis_0770)

MetaCyc: 60% identical to (S)-sulfopropanediol 2-dehydrogenase (Cupriavidus pinatubonensis JMP134)
1.1.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

• 3-sulfopropanediol degradation I (2/3 steps found)
• L-idonate degradation (1/3 steps found)
• ketogluconate metabolism (1/8 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.69

Use Curated BLAST to search for 1.1.1.69

Protein Sequence (253 amino acids)

>GFF4081 Gluconate 5-dehydrogenase (Xanthobacter sp. DMC5)
MFNLTSLFDLSGRTALVTGGSSGIGLAIAAGLGQAGASVVLAARRAAELDAACADLARNG
IVARAIVADLAADDGAELLAEAAGAGIDILVNAAGMNLRQPFGAVTREAFDLHMAVHVRA
PFMLVQKLAPAMAGRGWGRVLNIASLQSFRAFPNSAPYGAAKGAVAQVTRAMAEEWSRHG
ITANAIAPGFFPTALTQAVFEDEARAAHNAAQTAIGRNGRLEDLVGPAVFLASDAGAYVT
GQVLAVDGGFTAK