Protein Info for GFF4081 in Sphingobium sp. HT1-2

Annotation: Nodulin-related protein CC_0717

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details PF01988: VIT1" amino acids 24 to 231 (208 residues), 219.4 bits, see alignment E=2.7e-69

Best Hits

Swiss-Prot: 50% identical to PCL1_SCHPO: Fe(2+)/Mn(2+) transporter pcl1 (pcl1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: None (inferred from 76% identity to sjp:SJA_C1-23070)

Predicted SEED Role

"nodulin 21-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>GFF4081 Nodulin-related protein CC_0717 (Sphingobium sp. HT1-2)
MTTPRVEPPRPHHAVHYVNRVGWLRAAVLGANDGIVSTASLMTGIAASGATGESILLSGI
AALVAGAMSMAAGEYVSVSAQSDTERADLAKEKKALATQPHAEWEELRDIYVERGLDRDL
AGQVATQLMATDPLGAHARDELGISDLSTPRPVQAGLASAASFACGAAPPVVAAAIAPSL
AGISVVPVSLLCLLLLGYVGARLGGARPGRSMLRTVFWGALAMAVTAAAGHLFGAAI