Protein Info for GFF4081 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Flagellar hook-associated protein FlgK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00460: Flg_bb_rod" amino acids 5 to 34 (30 residues), 23.4 bits, see alignment (E = 7.3e-09) TIGR02492: flagellar hook-associated protein FlgK" amino acids 5 to 456 (452 residues), 332.4 bits, see alignment E=2.9e-103 PF22638: FlgK_D1" amino acids 91 to 321 (231 residues), 218.4 bits, see alignment E=1.6e-68 PF06429: Flg_bbr_C" amino acids 417 to 455 (39 residues), 35.5 bits, see alignment 8.3e-13

Best Hits

KEGG orthology group: K02396, flagellar hook-associated protein 1 FlgK (inferred from 52% identity to cvi:CV_1709)

Predicted SEED Role

"Flagellar hook-associated protein FlgK" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>GFF4081 Flagellar hook-associated protein FlgK (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTIHYTALSGALAAQTALAAASHNIANVMTPGFTRQGALFAAVGPFKGGVAATGGGVSVP
ALLRFSDGYKNMQMWQSNSELGRYNTSQPYMRQLEQVMGDDGSSLNSGLDVFFNALNAAS
VDPTSAPLRQQVITSAEALAQRFGNLNQVLNNQRASVAQQRTATVAQVNSLSAEIADLNE
KIAATRATGINPSSLMDARDLKIDALSNLVGLQVVEQADGSASVSLRSGVPLVAGSLAAT
LSTVNNPDGSQTLKLAFASESFTVTNGNLGGQLGGLDEFERTVLKPVIDDVAALAEEIAT
RVNTQMAVGFAMDGTPGTDLFQFDAASTGLLKVVDGLLGENLAFSSDPTKPGNSDNLQAL
IGLRDQPLTMPSLGTVRLGDVYTQIVGRLGTQNQQARAAHDTAKTVRNQAEESWKSTSGV
NTDEEAINIVQYQQMYQANMKVLAVSNELFDTTLAMFG