Protein Info for PS417_20885 in Pseudomonas simiae WCS417

Updated annotation (from data): Xanthine dehydrogenase (EC 1.17.1.4)
Rationale: Specifically important for utilizing Inosine. Automated validation from mutant phenotype: the predicted function (1.17.1.4) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: FAD-binding molybdopterin dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 TIGR02963: xanthine dehydrogenase, small subunit" amino acids 2 to 468 (467 residues), 697.9 bits, see alignment E=2.9e-214 PF00111: Fer2" amino acids 17 to 76 (60 residues), 28.5 bits, see alignment E=2.4e-10 PF01799: Fer2_2" amino acids 87 to 158 (72 residues), 97.8 bits, see alignment E=6.5e-32 PF00941: FAD_binding_5" amino acids 199 to 362 (164 residues), 172.2 bits, see alignment E=1.8e-54 PF03450: CO_deh_flav_C" amino acids 368 to 468 (101 residues), 122.9 bits, see alignment E=1.2e-39

Best Hits

KEGG orthology group: K13481, xanthine dehydrogenase small subunit [EC: 1.17.1.4] (inferred from 98% identity to pfs:PFLU4592)

Predicted SEED Role

"Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A (1.17.1.4)" in subsystem Purine Utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U079 at UniProt or InterPro

Protein Sequence (482 amino acids)

>PS417_20885 Xanthine dehydrogenase (EC 1.17.1.4) (Pseudomonas simiae WCS417)
MIQFLLNQELRSEHALDPNLTVLNYLREHLGKSGTKEGCASGDCGACTVVVGELHTDDTG
AEQIRYRSLNSCLTFVSSLHGKQLISVEDLKHQGQLHSVQKAMVECHGSQCGFCTPGFVM
SLFALQKNSDAPDNQKAHEALAGNLCRCTGYRPILAAAEQACCNKPQDQFDSRQAETIAR
LKAIAPTQTGELNSGDKRCLVPLTVADLADLYDAYPQARLLAGGTDLALEVTQFHRTLPV
MIYVGNIEEMKRIDDFDDRLEIGAAAALSDCYTALHHAYPDFGELLHRFASLQIRNQGTL
GGNIGNASPIGDSPPLLIALGAQIVLCKGETRRTLALEDYFIDYRVTARQDSEFIEKIIV
PKGHALFRAYKVSKRLDDDISAVCAAFNLKIDNGVIGEARVAFGGMAATPKRAKNCEAAL
VGATWNCATVEKACAALAEDFTPLSDFRASKEYRLLSAQNLLRKYFIELQTPHIETRVTA
YV