Protein Info for GFF4070 in Xanthobacter sp. DMC5

Annotation: Fumarate reductase iron-sulfur subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF13085: Fer2_3" amino acids 22 to 122 (101 residues), 93.5 bits, see alignment E=1.2e-30 TIGR00384: succinate dehydrogenase and fumarate reductase iron-sulfur protein" amino acids 30 to 240 (211 residues), 190.3 bits, see alignment E=1.6e-60 PF13183: Fer4_8" amino acids 159 to 229 (71 residues), 31.5 bits, see alignment E=3.3e-11 PF13534: Fer4_17" amino acids 159 to 230 (72 residues), 32.5 bits, see alignment E=1.6e-11

Best Hits

KEGG orthology group: K00245, fumarate reductase iron-sulfur protein [EC: 1.3.99.1] (inferred from 71% identity to mrd:Mrad2831_5989)

Predicted SEED Role

"Succinate dehydrogenase iron-sulfur protein (EC 1.3.99.1)" in subsystem Serine-glyoxylate cycle or Succinate dehydrogenase or TCA Cycle (EC 1.3.99.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>GFF4070 Fumarate reductase iron-sulfur subunit (Xanthobacter sp. DMC5)
MTSTSQNGRPAAAPAEETLRVRVWRGQADGAFEDFAVPRRASQTVLDVVTEIQRAQDPTL
SYRFACRVGMCGSCAMVVNGRPRWTCRTRVSEAVDGDILVLEPLRNLPIVKDLTVDMVPF
FEKWRDAHGAFEPGEAPPADFAPVRPDSPKRKAADAGVECINCGVCYSACDVVAWNKDYL
GPAALNRAWTLVNDERDRGNAARLAAVSGDVGCHSCHSHMSCTEFCPKDLAPTYAIAGLK
RATAPSPIGRLLALLVKS