Protein Info for GFF4070 in Sphingobium sp. HT1-2

Annotation: Methionine aminopeptidase (EC 3.4.11.18)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 TIGR00500: methionine aminopeptidase, type I" amino acids 29 to 274 (246 residues), 292.2 bits, see alignment E=1.6e-91 PF00557: Peptidase_M24" amino acids 38 to 266 (229 residues), 171 bits, see alignment E=1.5e-54

Best Hits

Swiss-Prot: 56% identical to MAP1_RICPR: Methionine aminopeptidase (map) from Rickettsia prowazekii (strain Madrid E)

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 95% identity to sjp:SJA_C1-19350)

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>GFF4070 Methionine aminopeptidase (EC 3.4.11.18) (Sphingobium sp. HT1-2)
MPDRRVYINRMTEYMTMTADAPVSRSTAIKLYDAAGFEGMRKAGRLAAEILDALVPHVVP
GVTTGELDDIVRRMTLDGGGVPATLGYRGYTHSCCISLNNVICHGIPGDYKLKDGDILNI
DVTPLVDGWHGDTSRMFIAGDAPIKAKRLVEITYECLMLGIEQAKPGNHLGDIGHVIQRH
AEKHRYGVVRDFCGHGLGRVFHDSPEVVHVGRPGTGPELKPGMFFTIEPMINIGKPGVKM
LDDGWTAVTRDRTLSAQFEHSIGITETGCEIFTKSPTGLDCPPYAR