Protein Info for GFF4066 in Xanthobacter sp. DMC5

Annotation: L(+)-tartrate dehydratase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00722: hydrolyase, tartrate alpha subunit/fumarate domain protein, Fe-S type
  • amino acids 11 to 280 (270 residues), 268 bits, E=3.9e-84
• PF05681: Fumerase
  • amino acids 11 to 280 (270 residues), 288.7 bits, E=2.2e-90

Best Hits

Swiss-Prot: 40% identical to TTDA_METJA: Putative L(+)-tartrate dehydratase subunit alpha (MJ1294) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03779, L(+)-tartrate dehydratase alpha subunit [EC: 4.2.1.32] (inferred from 82% identity to mrd:Mrad2831_5986)

Predicted SEED Role

"Fumarate hydratase class I, aerobic (EC 4.2.1.2); L(+)-tartrate dehydratase alpha subunit (EC 4.2.1.32)" (EC 4.2.1.2, EC 4.2.1.32)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle III (animals) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
• partial TCA cycle (obligate autotrophs) (7/8 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (8/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• TCA cycle VII (acetate-producers) (7/9 steps found)
• methylaspartate cycle (14/19 steps found)
• TCA cycle VI (Helicobacter) (6/9 steps found)
• mixed acid fermentation (11/16 steps found)
• pyruvate fermentation to propanoate I (4/7 steps found)
• reductive TCA cycle I (6/11 steps found)
• incomplete reductive TCA cycle (3/7 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• reductive TCA cycle II (6/12 steps found)
• L-glutamate degradation VIII (to propanoate) (4/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (25/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glyoxylate and dicarboxylate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.2, 4.2.1.32

Use Curated BLAST to search for 4.2.1.2 or 4.2.1.32

Protein Sequence (290 amino acids)

>GFF4066 L(+)-tartrate dehydratase subunit alpha (Xanthobacter sp. DMC5)
MDLNLDEVEKICADLYLRALQLLPPDIKAGFSELQRTETDATGQAILGTMVENIKVAERT
RNILCQDTGIPIYNITIGRNVTFDGAGLKEAVRRGAARSTRDNSLRSSVVHPITRKNDQN
SCGIRVPVIHIDFDDREETVSIEMIPKGSGSENGSFLKMLLPSDGITAVKRFVVDRVIEL
GGRVCPPTIVGVGIGGTSDLCMHLAKIAATRPLRTVCEDAEGAKIEAELSRAVNELGIGP
QGLGGRSTSFAVHVEVAATHITQNPVAVNIQCHSARRARATLTPGGIAFS