Protein Info for PS417_20830 in Pseudomonas simiae WCS417

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 123 to 141 (19 residues), see Phobius details amino acids 153 to 170 (18 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 214 to 233 (20 residues), see Phobius details amino acids 245 to 262 (18 residues), see Phobius details amino acids 268 to 288 (21 residues), see Phobius details PF00892: EamA" amino acids 11 to 140 (130 residues), 66.6 bits, see alignment E=1.5e-22 amino acids 154 to 285 (132 residues), 78.5 bits, see alignment E=3.1e-26

Best Hits

KEGG orthology group: None (inferred from 93% identity to pfs:PFLU4581)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1TSN0 at UniProt or InterPro

Protein Sequence (319 amino acids)

>PS417_20830 transporter (Pseudomonas simiae WCS417)
MNTPSPLKLTLVIASVILCWAYSPIGVHMGLLSYGPGQLALLRFLIASVFMAGVALVMGI
GRPRLWDLPWLLVLSFFGVFLHHTSLNYGQQFVTAGASSVLAQSAPLFSVLIAFFCLKER
VSLWRWSCVLLGLLGVLVVIWGDHGVGNIDPRGLLLLLAAVSWSLYFAIQKHYAHRYSPL
TMACYMVWGGTLMLCVNLPGLSSAVVQAPLPENLAVLVLGIFPSALAYLAWGYVLKHVEV
SRASVAMYLIPPVAMMMAATLLGEHITLQVVLGGVIVLASVAAISLEGRWRSVAQAKRAQ
PVAVEVLGDEGVAEIQGGR