Protein Info for GFF4065 in Variovorax sp. SCN45

Annotation: Uncharacterized cysteine-rich DUF326 protein bsYhjQ/STM1261

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 PF03860: DUF326" amino acids 3 to 23 (21 residues), 20.8 bits, see alignment 1.5e-08

Best Hits

Swiss-Prot: 55% identical to YHJQ_BACSU: Uncharacterized cysteine-rich protein YhjQ (yhjQ) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 78% identity to vap:Vapar_1029)

Predicted SEED Role

"Ferredoxin" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (109 amino acids)

>GFF4065 Uncharacterized cysteine-rich DUF326 protein bsYhjQ/STM1261 (Variovorax sp. SCN45)
MSHESYTACIEACNGCATACNHCASACLKEDNVKMMERCIALDIDCAAACQFAAAAMARG
SEHAKAICALCADICDACGAECEKHQMAHCKACAKTCKECAAACRAMAH