Protein Info for PS417_20800 in Pseudomonas simiae WCS417

Annotation: recombination protein RecR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 TIGR00615: recombination protein RecR" amino acids 2 to 196 (195 residues), 237.9 bits, see alignment E=3.3e-75 PF21176: RecR_HhH" amino acids 7 to 51 (45 residues), 78 bits, see alignment 9.2e-26 PF02132: RecR_ZnF" amino acids 54 to 74 (21 residues), 32.7 bits, see alignment (E = 1.2e-11) PF01751: Toprim" amino acids 82 to 162 (81 residues), 47.1 bits, see alignment E=5.5e-16 PF13662: Toprim_4" amino acids 82 to 171 (90 residues), 87 bits, see alignment E=2.1e-28 PF21175: RecR_C" amino acids 173 to 196 (24 residues), 36.4 bits, see alignment (E = 6.8e-13)

Best Hits

Swiss-Prot: 100% identical to RECR_PSEFS: Recombination protein RecR (recR) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K06187, recombination protein RecR (inferred from 100% identity to pfs:PFLU4575)

MetaCyc: 64% identical to recombination mediator protein RecR (Escherichia coli K-12 substr. MG1655)
RXN0-2606

Predicted SEED Role

"Recombination protein RecR" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U2F4 at UniProt or InterPro

Protein Sequence (200 amino acids)

>PS417_20800 recombination protein RecR (Pseudomonas simiae WCS417)
MSFSPLIRQLIDALRTLPGVGQKTAQRMALQLLERDRSGGTRLAQALSQAMTGVGHCRQC
RTLTEEELCPQCADPRRDDTLLCVVEGPMDVYAVEQTGYRGRYFVLKGHLSPLDGLGPEA
IGIPQLVARIEAQGTFTEVILATNPTVEGEATAHYIAQLLTNKGLITSRIAHGVPLGGEL
ELVDGGTLAHSFAGRKPIAL