Protein Info for GFF4052 in Xanthobacter sp. DMC5

Annotation: p-hydroxybenzoic acid efflux pump subunit AaeA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details PF00529: CusB_dom_1" amino acids 55 to 296 (242 residues), 30.3 bits, see alignment E=6.8e-11 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 56 to 229 (174 residues), 101 bits, see alignment E=3.3e-33 PF16576: HlyD_D23" amino acids 57 to 239 (183 residues), 50.5 bits, see alignment E=3.5e-17 PF13533: Biotin_lipoyl_2" amino acids 57 to 104 (48 residues), 56.5 bits, see alignment 3.7e-19 PF13437: HlyD_3" amino acids 167 to 244 (78 residues), 35 bits, see alignment E=4e-12

Best Hits

KEGG orthology group: None (inferred from 80% identity to azc:AZC_1357)

Predicted SEED Role

"COG1566: Multidrug resistance efflux pump"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>GFF4052 p-hydroxybenzoic acid efflux pump subunit AaeA (Xanthobacter sp. DMC5)
MTAIDIPAEKGTSVSRRVMGVLLTLTVVGVAGILGWRMWETYMTTPWTRDGTVRAYVVTV
APQISGRIVELPVKADQFVHKGDLLMVIEPSDYQIALANAEAAVARAKADLENKKAEAER
RTKLSAIAASDEEKQSFAASADMAVAAYQQALADRDQAKLNLSRTRIVSPVNGYVTNLLT
QVGDYGSSGQRALSVVDSDSFWVDGYFEETVLAGIHMGDKAKVALMAYPTPLTGHVTGIG
RGIAIPNVAPDVSGLASVNPVFTWVRLAQRVPVRIALDPVPPSVILSAGLTATVSISGK